The NADH-G_4Fe-4S_3 domain within your query sequence starts at position 113 and ends at position 153, and its E-value is 6.5e-19.

REGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRF
NADH-G_4Fe-4S_3

NADH-G_4Fe-4S_3

NADH-ubiquinone oxidoreductase-G iron-sulfur binding region
SMART ACC:SM000929
Description: -
InterPro ACC:IPR019574
InterPro abstract:

This entry represents the iron-sulphur binding domain of the G subunit. This domain consists of just two α-helices separated by a loop region that coordinates a [4Fe-4S] cluster through an unusual H-x(3)-C-x(2)-C-x(5)-C motif that includes one His and three Cys residues [ PUBMED:9756865 PUBMED:10694885 expand

GO function:oxidoreductase activity (GO:0016491)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 22 163 NADH-G_4Fe-4S_3 domains in 22 161 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing NADH-G_4Fe-4S_3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing NADH-G_4Fe-4S_3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a NADH-G_4Fe-4S_3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing NADH-G_4Fe-4S_3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019574
PfamNADH-G_4Fe-4S_3