The ChSh domain within your query sequence starts at position 111 and ends at position 173, and its E-value is 4.83e-33.

RGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSY
ChSh

ChSh

Chromo Shadow Domain
SMART ACC:SM000300
Description: -
InterPro ACC:IPR008251
InterPro abstract:

Chromo shadow domain is distantly related to chromo domain. It is always found in association with a chromo domain.

GO component:nucleus (GO:0005634)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 565 ChSh domains in 1 560 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ChSh domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ChSh domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the ChSh domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ChSh domain which could be assigned to a KEGG orthologous group, and not all proteins containing ChSh domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR008251