The SPRY domain within your query sequence starts at position 334 and ends at position 444, and its E-value is 8.1e-5.

RGKYYWEVDLKDYRRWTVGVCKDPWLRGRSYVATPTDLFLECLRKDDHYILITRIGGEHYIEKPVGQVGVFLDCEGGYVSFVDVAKSSLILSYSPGTFHCAVRPFFSAVYT
SPRY

SPRY

Domain in SPla and the RYanodine Receptor.
SMART ACC:SM000449
Description:Domain of unknown function. Distant homologues are domains in butyrophilin/marenostrin/pyrin homologues.
InterPro ACC:IPR003877
InterPro abstract:

The SPRY domain is a ~140-amino-acid protein interaction module involved in many important signalling pathways like RNA processing, regulation of histone H3 methylation, innate immunity, or embryonic development [ PUBMED:17189197 PUBMED:23139046 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 24 471 SPRY domains in 20 651 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SPRY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SPRY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SPRY domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SPRY domain.

ProteinDescriptionDisease / phenotype
MEFV_HUMANOMIM:249100 : Familial Mediterranean fever

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SPRY domain which could be assigned to a KEGG orthologous group, and not all proteins containing SPRY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamSPRY
InterProIPR003877