The B41 domain within your query sequence starts at position 207 and ends at position 402, and its E-value is 1.3e-80.

RHRNMHCKVSLLDDTVYECVVEKHAKGQDLLKRVCEHLNLLEEDYFGLALWDSATSKTWLDSAKEIKKQVRGVPWNFTFNVKFYPPDPAQLTEDITRYYLCLQLRQDIVAGRLPCSFATLALLGSYTIQSELGDYDPELHGMDYVSDFKLAPNQTKELEEKVMELHKSYRSMTPAQADLEFLENAKKLSMYGVDLH
B41

B41

Band 4.1 homologues
SMART ACC:SM000295
Description:Also known as ezrin/radixin/moesin (ERM) protein domains. Present in myosins, ezrin, radixin, moesin, protein tyrosine phosphatases. Plasma membrane-binding domain. These proteins play structural and regulatory roles in the assembly and stabilization of specialized plasmamembrane domains. Some PDZ domain containing proteins bind one or more of this family. Now includes JAKs.
InterPro ACC:IPR019749
InterPro abstract:

The FERM domain (F for 4.1 protein, E for ezrin, R for radixin and M for moesin) is a widespread protein module involved in localising proteins to the plasma membrane [ PUBMED:9757824 ]. FERM domains are found in a number of cytoskeletal-associated proteins that associate with various proteins at the interface between … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 33 941 B41 domains in 32 529 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing B41 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing B41 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Plasma-membrane-binding

Relevant references for this domain

Primary literature for the B41 domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the B41 domain.

ProteinDescriptionDisease / phenotype
MYO7A_HUMANOMIM:276903 : Usher syndrome, type 1B ; Deafness, autosomal recessive 2, neurosensory
OMIM:600060 : Deafness, autosomal dominant 11, neurosensory
OMIM:601317 : no description
MERL_HUMANOMIM:101000 : Neurofibromatosis, type 2 ; Meningioma, NF2-related, sporadic Schwannoma, sporadic ; Neurolemmomatosis ; Malignant mesothelioma, sporadic

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a B41 domain which could be assigned to a KEGG orthologous group, and not all proteins containing B41 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBand_41
InterProIPR019749
PROSITEBAND_41_3