The Pumilio domain within your query sequence starts at position 920 and ends at position 955, and its E-value is 5.48e-8.

RIRGHVLSLALQMYGCRVIQKALEFIPSDQQNEMVR
Pumilio

Pumilio

Pumilio-like repeats
SMART ACC:SM000025
Description:Pumilio-like repeats that bind RNA.
InterPro ACC:IPR001313
InterPro abstract:

Members of the Pumilio family of proteins (Puf) regulate translation and mRNA stability in a wide variety of eukaryotic organisms including mammals, flies, worms, slime mold, and yeast [ PUBMED:10662662 ]. Pumilio family members are characterised by the presence of eight tandem copies of an imperfectly repeated 36 amino … expand

GO function:RNA binding (GO:0003723)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 66 335 Pumilio domains in 9 739 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Pumilio domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Pumilio domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Pumilio domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Pumilio domain which could be assigned to a KEGG orthologous group, and not all proteins containing Pumilio domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001313