The PLEC domain within your query sequence starts at position 4170 and ends at position 4210, and its E-value is 1.05e-7.

RKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTY
PLEC

PLEC

Plectin repeat
SMART ACC:SM000250
Description: -
InterPro ACC:IPR001101
InterPro abstract:

Plectin may have a role in cross-linking intermediate filaments, in inter-linking intermediate filaments with microtubules and microfilaments and in anchoring intermediate filaments to the plasma and nuclear membranes. Plectin is recruited into hemidesmosomes, multiprotein complexes that facilitate adhesion of epithelia to the basement membrane, thereby providing linkage between the intracellular … expand

GO component:cytoskeleton (GO:0005856)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 65 103 PLEC domains in 3 644 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PLEC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PLEC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PLEC domain which could be assigned to a KEGG orthologous group, and not all proteins containing PLEC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001101
PfamPlectin_repeat