The SpoU_sub_bind domain within your query sequence starts at position 49 and ends at position 127, and its E-value is 3.31e-11.

RLFGLSPCLLALRAARRRVARLLLQAGKAGLQGERAELLRVAEARGIPVLRPRRQKLDALCGYQVHQGVCMEVSPLRPR
SpoU_sub_bind

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding
SMART ACC:SM000967
Description:This domain is a RNA 2'-O ribose methyltransferase substrate binding domain.
InterPro ACC:IPR013123
InterPro abstract:

Most cellular RNAs undergo a number of post-transcriptional nucleoside modifications. While the biological role of many of these modifications is unknown, some have been shown to be necessary for cell growth or for resistance to antibiotics [ PUBMED:8266080 PUBMED:9187657 expand

GO function:methyltransferase activity (GO:0008168)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 29 726 SpoU_sub_bind domains in 29 725 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SpoU_sub_bind domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SpoU_sub_bind domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SpoU_sub_bind domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SpoU_sub_bind domain which could be assigned to a KEGG orthologous group, and not all proteins containing SpoU_sub_bind domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013123
PfamSpoU_sub_bind