The CDC37_C domain within your query sequence starts at position 287 and ends at position 379, and its E-value is 1.25e-43.

RLGPGGLDPVEVYESLPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKSGEAKEGEEAGPGDPLLEAVPKAGNEKDVSA
CDC37_C

CDC37_C

Cdc37 C terminal domain
SMART ACC:SM001069
Description:Cdc37 is a protein required for the activity of numerous eukaryotic protein kinases. This domains corresponds to the C terminal domain whose function is unclear. It is found C terminal to the Hsp90 chaperone (Heat shocked protein 90) binding domain PF08565 and the N terminal kinase binding domain of Cdc37 (PUBMED:16098195).
InterPro ACC:IPR013873
InterPro abstract:

Cdc37 is a protein required for the activity of numerous eukaryotic protein kinases. This entry corresponds to the C-terminal domain whose function is unclear. It is found C-terminal to the Hsp90 chaperone (heat shock protein 90) binding domain ( IPR013874 ) and the N-terminal kinase binding domain of Cdc37 ( … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 390 CDC37_C domains in 1 387 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CDC37_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CDC37_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CDC37_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing CDC37_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCDC37_C
InterProIPR013873