The Asparaginase domain within your query sequence starts at position 10 and ends at position 348, and its E-value is 2.67e-111.

RLLAIYTGGTIGMRSEGGVLVPGRGLAAVLKTLHMFHDEEYAQAHSLPEDTLVLPPASPDQRIIYTVLECQPLFDSSDMTITEWVQIAQTIERHYAQYQGFVVIHGTDTMAFAASVLSFMLENLQKPVVLTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQLFRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKACGKSHLVVHSSMEPDVGLLRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGPTKPDLLQELRVAAEQGLIIVNCTHCLQGAVTSDYASGMAMAGAGIVSGFDMTSEAALAKLSYVLGQPGLSLNDR
Asparaginase

Asparaginase

SMART ACC:SM000870
Description:Asparaginase, which is found in various plant, animal and bacterial cells, catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma (PUBMED:3026924). The enzyme is effective in the treatment of human malignant lymphomas, which have a diminished capacity to produce asparagine synthetase: in order to survive, such cells absorb asparagine from blood plasma (PUBMED:2407723), (PUBMED:3379033) - if Asn levels have been depleted by injection of asparaginase, the lymphoma cells die.
InterPro ACC:IPR006034
InterPro abstract:

L-Asparaginases ( EC:3.5.1.1 ) hydrolyse L-asparagine to L-aspartate and ammonia. Enzymes with asparaginase activity play an important role in the metabolism of all living organisms [ PUBMED:11996000 PUBMED:17143335 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 19 043 Asparaginase domains in 19 037 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Asparaginase domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Asparaginase domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the Asparaginase domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Asparaginase domain which could be assigned to a KEGG orthologous group, and not all proteins containing Asparaginase domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006034
PfamAsparaginase