The SPT2 domain within your query sequence starts at position 573 and ends at position 680, and its E-value is 1.3e-32.

RLPFPTGYKRPREYEEDDDDEYDSEMDDFIEDEGEPQEEISKHIREIFGYDRKKYKDESDYALRYMESSWKEQQKEEAKSLRLGMQEDLEEMRREEEELKRRKAKKLK
SPT2

SPT2

SPT2 chromatin protein
SMART ACC:SM000784
Description:This entry includes the Saccharomyces cerevisiae protein SPT2 which is a chromatin protein involved in transcriptional regulation (PUBMED:15563464).
InterPro ACC:IPR013256
InterPro abstract:

This entry includes the Saccharomyces cerevisiae (Baker's yeast) protein SPT2 which is a chromatin protein involved in transcriptional regulation [ PUBMED:15563464 ].

These proteins shows conservation of several domains across numerous species, including having a cluster of positively charged amino acids. This … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 333 SPT2 domains in 1 333 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SPT2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SPT2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription
Binding / catalysis:DNA binding

Relevant references for this domain

Primary literature for the SPT2 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SPT2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing SPT2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013256
PfamSPT2