The Raptor_N domain within your query sequence starts at position 54 and ends at position 207, and its E-value is 2.3e-98.

RMKTVSVALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFK
Raptor_N

Raptor_N

Raptor N-terminal CASPase like domain
SMART ACC:SM001302
Description:This domain is found at the N-terminus of the Raptor protein. It has been identified to have a CASPase like structure PMID:15450605. It conserves the characteristic cys/his dyad of the caspases suggesting it may have a peptidase activity.
InterPro ACC:IPR029347
InterPro abstract:

Human Raptor is involved in the control of the mammalian target of rapamycin complex 1 (mTORC1) activity which regulates cell growth and survival, and autophagy in response to nutrient and hormonal signals. It functions as a scaffold for recruiting mTORC1 substrates [ PUBMED:12150925 ].

All Raptor orthologs … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 906 Raptor_N domains in 1 904 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Raptor_N domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Raptor_N domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Raptor_N domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Raptor_N domain which could be assigned to a KEGG orthologous group, and not all proteins containing Raptor_N domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRaptor_N
InterProIPR029347