The TGc domain within your query sequence starts at position 247 and ends at position 340, and its E-value is 6.25e-42.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 94316682 ) for details.

RMPVRYGQCWVFSGILTTALRAVGIPARSVTNFESAHDTEKNLTVDIYLDESGKTIPHLTKDSVWNFHVWTDAWMKRQDLPHGYDGWQVLDSTP
TGc

TGc

Transglutaminase/protease-like homologues
SMART ACC:SM000460
Description:Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.
InterPro ACC:IPR002931
InterPro abstract:

This domain is found in many proteins known to have transglutaminase activity, i.e. which cross-link proteins through an acyl-transfer reaction between the gamma-carboxamide group of peptide-bound glutamine and the ε-amino group of peptide-bound lysine, resulting in a epsilon-(gamma-glutamyl)lysine isopeptide bond. Transglutaminases have been found in a diverse range of species, from bacteria … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 34 556 TGc domains in 34 489 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TGc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TGc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the TGc domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the TGc domain.

ProteinDescriptionDisease / phenotype
TGM1_HUMANOMIM:190195 : Ichthyosis, lamellar, autosomal recessive
OMIM:242300 : Ichthyosiform erythroderma, congenital
OMIM:242100 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TGc domain which could be assigned to a KEGG orthologous group, and not all proteins containing TGc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002931