The PTBI domain within your query sequence starts at position 18 and ends at position 110, and its E-value is 5.71e-35.

RNKFKVINVDDDGNELGSGVMELTDTELILYTRKRDSVKWHYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCARAEELFNMLQEIMQNNSI
PTBI

PTBI

Phosphotyrosine-binding domain (IRS1-like)
SMART ACC:SM000310
Description: -
InterPro ACC:IPR002404
InterPro abstract:

Insulin receptor substrate (IRS) molecules are mediators in insulin signaling and play a role in maintaining basic cellular functions such as growth and metabolism. They act as docking proteins between the insulin receptor and a complex network of intracellular signaling molecules containing Src homology 2 (SH2) domains. Four members (IRS-1, IRS-2, IRS-3, IRS-4) of this family have been identified … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 374 PTBI domains in 4 370 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PTBI domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PTBI domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Phosphotyrosine-binding

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PTBI domain which could be assigned to a KEGG orthologous group, and not all proteins containing PTBI domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002404