The HhH2 domain within your query sequence starts at position 847 and ends at position 880, and its E-value is 2.94e-11.

RNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEF
HhH2

HhH2

Helix-hairpin-helix class 2 (Pol1 family) motifs
SMART ACC:SM000279
Description: -
InterPro ACC:IPR008918
InterPro abstract:

The helix-hairpin-helix (HhH) motif is an around 20 amino acids domain present in prokaryotic and eukaryotic non-sequence-specific DNA binding proteins. The HhH motif is similar to, but distinct from, the helix-turn-helix (HtH) and the helix-loop-helix (HLH) motifs. All three motifs have two helices (H1 and H2) connected by a short turn. DNA-binding proteins with a HhH structural motif are involved … expand

GO function:DNA binding (GO:0003677), catalytic activity (GO:0003824)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 35 926 HhH2 domains in 35 913 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HhH2 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HhH2 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transport

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HhH2 domain which could be assigned to a KEGG orthologous group, and not all proteins containing HhH2 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR008918