The Kin17_mid domain within your query sequence starts at position 52 and ends at position 178, and its E-value is 5.41e-89.

RQLLLASENPQQFMDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLCKVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDLDDEEKTAKFIEEQVR
Kin17_mid

Kin17_mid

Domain of Kin17 curved DNA-binding protein
SMART ACC:SM001253
Description:Kin17_mid is the conserved central 169 residue region of a family of Kin17 proteins. Towards the N-terminal end there is a zinc-finger domain, and in human and mouse members there is a RecA-like domain further downstream. The Kin17 protein in humans forms intra-nuclear foci during cell proliferation and is re-distributed in the nucleoplasm during the cell cycle (PUBMED:10964102).
InterPro ACC:IPR019447
InterPro abstract:

Kin17 is a highly conserved protein that participates in DNA replication, DNA repair and cell cycle progression [ PUBMED:10964102 PUBMED:15831485 PUBMED:28454391 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 678 Kin17_mid domains in 1 676 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Kin17_mid domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Kin17_mid domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Kin17_mid domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Kin17_mid domain which could be assigned to a KEGG orthologous group, and not all proteins containing Kin17_mid domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019447
PfamKin17_mid