The MIT domain within your query sequence starts at position 235 and ends at position 313, and its E-value is 1.12e-20.

RRDYLEKAGELIKLALKKEEEDDYEAASDFYRKGVDLLLEGVQGESSPTRREAVKRRTAEYLMRAESICSLRAAPQLHT
MIT

MIT

Microtubule Interacting and Trafficking molecule domain
SMART ACC:SM000745
Description: -
InterPro ACC:IPR007330
InterPro abstract:

The MIT domain forms an asymmetric three-helix bundle. It is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking.

A 'variant' MIT domain has been described at the N-terminal region of a related AAA-ATPase, mammalian katanin p60 represented … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 412 MIT domains in 4 681 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MIT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MIT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MIT domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MIT domain which could be assigned to a KEGG orthologous group, and not all proteins containing MIT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR007330