The BRCT domain within your query sequence starts at position 1612 and ends at position 1691, and its E-value is 2.45e1.

RRLLEDYEIHVTPGVQPPPPQMGEIISCCGGTFLPSMPHSYKLHRVIITCTEDLPRCAIPSRLGLPLLSPEFLLTGVLKQ
BRCT

BRCT

breast cancer carboxy-terminal domain
SMART ACC:SM000292
Description: -
InterPro ACC:IPR001357
InterPro abstract:

The breast cancer susceptibility gene contains at its C terminus two copies of a conserved domain that was named BRCT for BRCA1 C terminus. This domain of about 95 amino acids is found in a large variety of proteins involved in DNA repair, recombination and cell cycle control [ PUBMED:8673121 PUBMED:9034168 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 72 534 BRCT domains in 52 588 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing BRCT domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing BRCT domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the BRCT domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the BRCT domain.

ProteinDescriptionDisease / phenotype
BRCA1_HUMANOMIM:113705 : Breast cancer-1 ; Ovarian cancer ; Breast-ovarian cancer ; Papillary serous carcinoma of the peritoneum

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a BRCT domain which could be assigned to a KEGG orthologous group, and not all proteins containing BRCT domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamBRCT
InterProIPR001357