The S4 domain within your query sequence starts at position 108 and ends at position 179, and its E-value is 6.84e-4.

RRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAK
S4

S4

S4 RNA-binding domain
SMART ACC:SM000363
Description: -
InterPro ACC:IPR002942
InterPro abstract:

The S4 domain is a small domain consisting of 60-65 amino acid residues that was detected in the bacterial small ribosomal subunit protein uS4, eukaryotic ribosomal uS4 (also known as S9), two families of pseudouridine synthases, a novel family of predicted RNA methylases, a yeast protein containing a pseudouridine synthetase and a deaminase domain, bacterial tyrosyl-tRNA synthetases, and a number … expand

GO function:RNA binding (GO:0003723)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 146 383 S4 domains in 146 322 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing S4 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing S4 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:RNA-binding

Relevant references for this domain

Primary literature for the S4 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a S4 domain which could be assigned to a KEGG orthologous group, and not all proteins containing S4 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamS4
InterProIPR002942
PROSITERIBOSOMAL_S4