The DTW domain within your query sequence starts at position 65 and ends at position 164, and its E-value is 3.12e-4.

RRPECGRCSRPQKVCLCPYLPVRPLQISTHLYIIQHPAEVQLKTSVCSQYVIRMQPTNRCLSTLECAAVALSILEKNNCIQETLLRPLQALCSFQLQHGA
DTW

DTW

SMART ACC:SM001144
Description:This presumed domain is found in bacterial and eukaryotic proteins. Its function is unknown. The domain contains multiple conserved motifs including a DTXW motif that this domain has been named after.
InterPro ACC:IPR005636
InterPro abstract:

This presumed domain is found DTWD1/DTWD2 from humans and YfiP (also known as TapT) from Escherichia coli. The domain contains multiple conserved motifs including a DTXW motif that this domain has been named after. DTW domain containing protein may have a SAM-dependent acp transferase activity [ PUBMED:31863583 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 401 DTW domains in 7 399 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DTW domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DTW domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DTW domain which could be assigned to a KEGG orthologous group, and not all proteins containing DTW domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

Links to other resources describing this domain

InterProIPR005636
PfamDTW