The FF domain within your query sequence starts at position 404 and ends at position 464, and its E-value is 6.94e-3.

RRRNIQALKSILDGMSSVNFQTTWSQAQQYLMDNPSFAQDQQLQNMDKEDALICFEEHIRA
FF

FF

Contains two conserved F residues
SMART ACC:SM000441
Description:A novel motif that often accompanies WW domains. Often contains two conserved Phe (F) residues.
InterPro ACC:IPR002713
InterPro abstract:

The FF domain may be involved in protein-protein interaction [ PUBMED:10390614 ]. It often occurs as multiple copies and often accompanies WW domains IPR001202. PRP40 from yeast encodes a novel, essential splicing component that associates … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 19 195 FF domains in 4 383 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FF domain which could be assigned to a KEGG orthologous group, and not all proteins containing FF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR002713