The ZnMc domain within your query sequence starts at position 110 and ends at position 269, and its E-value is 3.76e-59.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 96311273 ) for details.

RTLKWSQTNLTYRIVNYTPDMSHSEVEKAFRKAFKVWSDVTPLNFTRIYDGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFIVAAHELGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQFLYGP
ZnMc

ZnMc

Zinc-dependent metalloprotease
SMART ACC:SM000235
Description:Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
InterPro ACC:IPR006026
InterPro abstract:
This entry includes metallopeptidases associated with MEROPS peptidase families: M7, M8, M10 and M12, all of which are members of clan MA(M).

The majority of zinc-dependent metallopeptidases (with the notable exception of the carboxypeptidases) share a common pattern of primary structure [ PUBMED:2914602 expand

GO process:proteolysis (GO:0006508)
GO function:metallopeptidase activity (GO:0008237), zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 34 425 ZnMc domains in 34 168 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ZnMc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ZnMc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Peptidase; zinc-binding

Relevant references for this domain

Primary literature for the ZnMc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ZnMc domain which could be assigned to a KEGG orthologous group, and not all proteins containing ZnMc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006026