The DUF1899 domain within your query sequence starts at position 4 and ends at position 68, and its E-value is 7.45e-34.

RVVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSAFCAVNPKFLAIIVEAGGGGAFIVLPLAKTG
DUF1899

DUF1899

SMART ACC:SM001166
Description:This set of domains is found in various eukaryotic proteins. Function is unknown.
InterPro ACC:IPR015048
InterPro abstract:

Coronins are evoluntionarily conserved proteins, mainly involved in actin cytoskeleton organisation.Typically Coronins contain a DUF1899 domain, a series of WD40 repeats, a DUF1900 domain ( IPR015049 ) and a C-terminal coiled-coil domain [ PUBMED:18925370 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 857 DUF1899 domains in 4 244 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF1899 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF1899 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF1899 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF1899 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF1899
InterProIPR015048