The calpain_III domain within your query sequence starts at position 366 and ends at position 523, and its E-value is 2.57e-84.

RWHSTFYEGSWRRGSTAGGCRNHPETFWSNPQFKISLPEVDDPEDDSEKNEMVCTCLVALMQKNWRHAREGPQLLTIGFVIFSVPKEFQNLRDIHLKKDFFLKYRDHGFSEIFINSREVNSHLRLPPGEYVIIPSTYEPHKDADFLLRVFTEKHSETW
calpain_III

calpain_III

SMART ACC:SM000720
Description: -
InterPro ACC:IPR022683
InterPro abstract:

A cysteine peptidase is a proteolytic enzyme that hydrolyses a peptide bond using the thiol group of a cysteine residue as a nucleophile. Hydrolysis involves usually a catalytic triad consisting of the thiol group of the cysteine, the imidazolium ring of a histidine, and a third residue, usually asparagine or aspartic acid, to orientate and activate the imidazolium ring. In only one family of … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 6 946 calpain_III domains in 6 521 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing calpain_III domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing calpain_III domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a calpain_III domain which could be assigned to a KEGG orthologous group, and not all proteins containing calpain_III domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR022683
PfamCalpain_III