The DUF4206 domain within your query sequence starts at position 463 and ends at position 664, and its E-value is 1.01e-108.

RYCEYLGKYFCASCHSSAESCIPARILTMWDFRKYQVSDFSKWLLDSVWHQPVFKLLGGHHSLYAKAKELDRVKDLQEQLFHIKKLLKTCRFADSVLKEFEQVPSHLTDECHIFSMDDFLRTKKGLLAPLLKDILRASLAHVDSCELCQGKGFICEFCQSTTVIFPFQTTTCRRCAACRACFHKQCFQSSRCPRCARIIARR
DUF4206

DUF4206

SMART ACC:SM001175
Description:This is a family of cysteine-rich proteins. Many members also carry a pleckstrin-homology domain,SM00233.
InterPro ACC:IPR025258
InterPro abstract:

This is the Rubicon homology domain (RH) characterised at the C-terminal of Rubicon, PLEKHM1 and Pacer, proteins that modulate late steps in autophagy [ PUBMED:32632011 PUBMED:30581147 ]. Rubicon (RUBCN) negatively regulates autophagy and endolysosomal … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 211 DUF4206 domains in 3 211 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing DUF4206 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing DUF4206 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a DUF4206 domain which could be assigned to a KEGG orthologous group, and not all proteins containing DUF4206 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamDUF4206
InterProIPR025258