The CO_deh_flav_C domain within your query sequence starts at position 421 and ends at position 525, and its E-value is 1.16e-24.

SAFKQASRREDDIAKVTSGMRVLFKPGTTEVQELSLCFGGMADRTVSALKTTPKQLSKSWNEELLQDVCAGLAEELHLAPDAPGGMVEFRRTLTLSFFFKFYLTV
CO_deh_flav_C

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain
SMART ACC:SM001092
Description: -
InterPro ACC:IPR005107
InterPro abstract:

Proteins containing this domain form structural complexes with other known families, such as IPR008274 and IPR001041. The carbon monoxide (CO) dehydrogenase of Oligotropha carboxidovorans is a heterotrimeric complex composed … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 28 996 CO_deh_flav_C domains in 28 937 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CO_deh_flav_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CO_deh_flav_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CO_deh_flav_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing CO_deh_flav_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamCO_deh_flav_C
InterProIPR005107