The HDAC_interact domain within your query sequence starts at position 551 and ends at position 651, and its E-value is 3.31e-61.

SCKRLGSSYRALPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATIRVLEAIQKKLSRLSAEEQAK
HDAC_interact

HDAC_interact

Histone deacetylase (HDAC) interacting
SMART ACC:SM000761
Description:This domain is found on transcriptional regulators. It forms interactions with histone deacetylases.
InterPro ACC:IPR013194
InterPro abstract:

This domain is found in the transcriptional repressor Sin3. It forms interactions with histone deacetylases [ PUBMED:12773392 ].

Budding yeast Sin3 is a component of both the Rpd3S and Rpd3L histone deacetylase complexes [ PUBMED:16314178 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 785 HDAC_interact domains in 2 783 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing HDAC_interact domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing HDAC_interact domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Transcription

Relevant references for this domain

Primary literature for the HDAC_interact domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a HDAC_interact domain which could be assigned to a KEGG orthologous group, and not all proteins containing HDAC_interact domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamHDAC_interact
InterProIPR013194