The CPSase_L_D3 domain within your query sequence starts at position 735 and ends at position 858, and its E-value is 9.7e-59.

SDMELETPTDKRIFVVAAALWAGYSVERLYELTRIDCWFLHRMKRIVTHAQLLEQHRGQALPQDLLHQAKCLGFSDKQIALAVLSTELAVRKLRQELGICPAVKQIDTVAAEWPAQTNYLYLTY
CPSase_L_D3

CPSase_L_D3

Carbamoyl-phosphate synthetase large chain, oligomerisation domain
SMART ACC:SM001096
Description:Carbamoyl-phosphate synthase catalyses the ATP-dependent synthesis of carbamyl-phosphate from glutamine or ammonia and bicarbonate. The carbamoyl-phosphate synthase (CPS) enzyme in prokaryotes is a heterodimer of a small and large chain.
InterPro ACC:IPR005480
InterPro abstract:

This entry represents the oligomerisation domain found in the large subunit of carbamoyl phosphate synthases as well as in certain other carboxy phosphate domain-containing enzymes. This domain forms a primarily α-helical fold [ PUBMED:10089390 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 32 225 CPSase_L_D3 domains in 32 224 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CPSase_L_D3 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CPSase_L_D3 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the CPSase_L_D3 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CPSase_L_D3 domain which could be assigned to a KEGG orthologous group, and not all proteins containing CPSase_L_D3 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005480
PfamCPSase_L_D3