The MHC_II_beta domain within your query sequence starts at position 40 and ends at position 114, and its E-value is 4.64e-47.

SECHFYNGTQRVRLLERYFYNLEENLRFDSDVGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEISD
MHC_II_beta

MHC_II_beta

Class II histocompatibility antigen, beta domain
SMART ACC:SM000921
Description:Class II MHC glycoproteins are expressed on the surface of antigen-presenting cells (APC), including macrophages, dendritic cells and B cells. MHC II proteins present peptide antigens that originate extracellularly from foreign bodies such as bacteria. Proteins from the pathogen are degraded into peptide fragments within the APC, which sequesters these fragments into the endosome so they can bind to MHC class II proteins, before being transported to the cell surface. MHC class II receptors display antigens for recognition by helper T cells (stimulate development of B cell clones) and inflammatory T cells (cause the release of lymphokines that attract other cells to site of infection) (PUBMED:15120183).
InterPro ACC:IPR000353
InterPro abstract:

This entry represents the N-terminal domain (also called beta-1 domain) of the beta chain of class II MHC glycoproteins from vertebrates.

Major Histocompatibility Complex (MHC) glycoproteins are heterodimeric cell surface receptors that function to present antigen peptide fragments to T cells responsible for cell-mediated immune responses. MHC molecules can be subdivided into two groups … expand

GO process:immune response (GO:0006955), antigen processing and presentation (GO:0019882)
GO component:membrane (GO:0016020), MHC class II protein complex (GO:0042613)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 14 509 MHC_II_beta domains in 14 487 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MHC_II_beta domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MHC_II_beta domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Interaction (with the environment)

Relevant references for this domain

Primary literature for the MHC_II_beta domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MHC_II_beta domain which could be assigned to a KEGG orthologous group, and not all proteins containing MHC_II_beta domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMHC_II_beta
InterProIPR000353