The N-SET domain within your query sequence starts at position 1692 and ends at position 1836, and its E-value is 1.54e-67.

SEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKREDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPMDTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLL
N-SET

N-SET

COMPASS (Complex proteins associated with Set1p) component N
SMART ACC:SM001291
Description:The n-SET or N-SET domain is a component of the COMPASS complex, associated with SET1, conserved in yeasts and in other eukaryotes up to humans. The COMPASS complex functions to methylate the fourth lysine of Histone 3 and for the silencing of genes close to the telomeres of chromosomes PMID:11805083. This domain promotes trimethylation in conjunction with an RRM domain PMID:15775977and is necessary for binding of the Spp1 component of COMPASS into the complex PMID:16921172.
InterPro ACC:IPR024657
InterPro abstract:

The COMPASS complex (complex proteins associated with Set1p) is conserved in yeasts and in other eukaryotes up to humans. The COMPASS complex functions to methylate the fourth lysine of Histone 3 and for the silencing of genes close to the telomeres of chromosomes [ PUBMED:11805083 ].

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 652 N-SET domains in 1 648 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing N-SET domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing N-SET domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a N-SET domain which could be assigned to a KEGG orthologous group, and not all proteins containing N-SET domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamN-SET
InterProIPR024657