The TLDc domain within your query sequence starts at position 704 and ends at position 866, and its E-value is 1.05e-80.

SELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIWAFE
TLDc

TLDc

domain in TBC and LysM domain containing proteins
SMART ACC:SM000584
Description: -
InterPro ACC:IPR006571
InterPro abstract:

The Tre2/Bub2/Cdc16 (TBC), lysin motif (LysM), domain catalytic (TLDc) domain is present in all eukaryotes, and its primary sequence is highly conserved among species. The TLDc domain is present in several proteins that share a protective function against oxidative stress (OS). The TLDc domain alone is able to confer oxidative resistance properties to all the TLDc members. The TLDc domain-containing … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 7 015 TLDc domains in 7 012 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TLDc domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TLDc domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Catalytic

Relevant references for this domain

Primary literature for the TLDc domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TLDc domain which could be assigned to a KEGG orthologous group, and not all proteins containing TLDc domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006571