The MIF4G domain within your query sequence starts at position 47 and ends at position 264, and its E-value is 2.62e-46.

SEYVQDFLNHLTEQPGSFETEIEQFAETLNGWVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEAKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDTWKEKGKTDMEEIIQRIENVVLDANCSRDVKQMLLKLVELRSSN
MIF4G

MIF4G

Middle domain of eukaryotic initiation factor 4G (eIF4G)
SMART ACC:SM000543
Description:Also occurs in NMD2p and CBP80. The domain is rich in alpha-helices and may contain multiple alpha-helical repeats. In eIF4G, this domain binds eIF4A, eIF3, RNA and DNA. Ponting (TiBS) "Novel eIF4G domain homologues (in press)
InterPro ACC:IPR003890
InterPro abstract:

MIF4G stands for middle domain of eukaryotic initiation factor 4G (eIF4G). eIF4G is a component of the translation initiation factor eIF4F complex and the cytoplasmic cap-binding protein complex (CBC). In the cytoplasm, cap binding complexes, distinct in their composition from nuclear cap-binding complexes, have important roles in the initiation of mRNA translation.

The MIF4G domain also … expand

GO function:RNA binding (GO:0003723), protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 13 738 MIF4G domains in 11 270 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MIF4G domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MIF4G domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MIF4G domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MIF4G domain which could be assigned to a KEGG orthologous group, and not all proteins containing MIF4G domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003890