The RICTOR_phospho domain within your query sequence starts at position 1084 and ends at position 1189, and its E-value is 4.06e-58.

SFPFFGSSKLVKNRILNSLTLPTKKHRSSSDPKGGKLSSENKTSNRRIRTLTEPSVDLNHSEDFTSSSAQKSLQLEPSFVGNKHLEDAGSTPSIGENDLKFPKSFG
RICTOR_phospho

RICTOR_phospho

Rapamycin-insensitive companion of mTOR, phosphorylation-site
SMART ACC:SM001309
Description:Rictor appears to serve as a scaffolding protein that is important for maintaining mTORC2 integrity. The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTROC1 and mTORC2, important for nutrient- and growth-factor signalling. This short region is the phoshorylation site. Rictor does interact with 14-3-3 in a Thr1135-dependent manner. Rictor can be inhibited by short-term rapamycin treatment showing that Thr1135 is an mTORC1-regulated site.
InterPro ACC:IPR029259
InterPro abstract:

The mammalian target of rapamycin (mTOR) is a conserved Ser/Thr kinase that forms two functionally distinct complexes, mTORC1 and mTORC2, important for nutrient- and growth-factor signalling [ PUBMED:20418915 ]. Rictor (rapamycin-insensitive companion of mTOR) is an essential component of the complex mTORC2 [ expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 531 RICTOR_phospho domains in 477 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RICTOR_phospho domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RICTOR_phospho domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RICTOR_phospho domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RICTOR_phospho domain which could be assigned to a KEGG orthologous group, and not all proteins containing RICTOR_phospho domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR029259
PfamRICTOR_phospho