The PA2c domain within your query sequence starts at position 21 and ends at position 128, and its E-value is 1.4e-37.

All catalytic sites are present in this domain, and marked green in the sequence below. Check the literature (PubMed 99175087 ) for details.

SFWQFQRMVKHVTGRSAFFSYYGYGCYCGLGGKGLPVDATDRCCWAHDCCYHKLKEYGCQPILNAYQFTIVNGTVTCGCTVASSCLCGQKACECDKQSVYCFKENLAT
PA2c

PA2c

Phospholipase A2
SMART ACC:SM000085
Description: -
InterPro ACC:IPR016090
InterPro abstract:

Proteins containing this domain include eukaryotic phospholipase A2 enzymes (PLA2; EC:3.1.1.4 ), small lipolytic enzymes that release fatty acids from the second carbon group of glycerol, usually in a metal-dependent reaction, to generate lysophospholipid (LysoPL) and a free fatty acid (FA) [ PUBMED:11872155 expand

GO process:arachidonate secretion (GO:0050482), phospholipid metabolic process (GO:0006644)
GO function:phospholipase A2 activity (GO:0004623)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 804 PA2c domains in 5 499 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PA2c domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PA2c domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PA2c domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PA2c domain which could be assigned to a KEGG orthologous group, and not all proteins containing PA2c domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PROSITEPS00119
InterProIPR016090