The G8 domain within your query sequence starts at position 3035 and ends at position 3173, and its E-value is 6.5e-57.

SFWQSSPENNYTVPRPGANVIIPEGTWIVADVDIPPVERLIIWGVLEMEDKSEIGVAGPTYRRVVLNATYISVQGGRLIGGWEDNPFKGELQIVLRGNHSTPEWAFPDGPNQGAKVLGVFGELDLHGLPHSVYKTKLLE
G8

G8

SMART ACC:SM001225
Description:This domain is found in disease proteins PKHD1 and KIAA1199 and is named G8 after its 8 conserved glycines. It is predicted to contain 10 beta strands and an alpha helix.
InterPro ACC:IPR019316
InterPro abstract:

This entry represents a domain found in disease proteins PKHD1 and CEMIP2 (also known as KIAA1199) and is named G8 after its 8 conserved glycines. It is predicted to contain 10 β-strands and an α-helix [ PUBMED:16632497 PUBMED:37234743 ]. CEMIP2 … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 2 452 G8 domains in 1 853 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing G8 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing G8 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the G8 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a G8 domain which could be assigned to a KEGG orthologous group, and not all proteins containing G8 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019316
PfamG8