The SPRY domain within your query sequence starts at position 348 and ends at position 472, and its E-value is 2.54e-30.

SGRHYWEVGMNLTGDALWALGVCRDNVSRKDRVLKSPENGFWVVQLSKGKKQLSLLPNSTLVTLTEPPSHMGIFLDFQAGEVSFYSVNDGSHLHSFSQAAFPGPLLPFFCLGAPKSGQMVISTVT

SPRY Domain in SPla and the RYanodine Receptor.
SMART ACC:	SM000449
Description:	Domain of unknown function. Distant homologues are domains in butyrophilin/marenostrin/pyrin homologues.
InterPro ACC:	IPR003877
InterPro abstract:	The SPRY domain is a ~140-amino-acid protein interaction module involved in many important signalling pathways like RNA processing, regulation of histone H3 methylation, innate immunity, or embryonic development [ PUBMED:17189197 PUBMED:23139046 … expand The SPRY domain is a ~140-amino-acid protein interaction module involved in many important signalling pathways like RNA processing, regulation of histone H3 methylation, innate immunity, or embryonic development [ PUBMED:17189197 PUBMED:23139046 PUBMED:27812363 ]. It can be divided into 11 subfamilies based on amino acid sequence similarity or the presence of additional protein domains. Functionally, SPRY domains mediate critical interactions in diverse pathways: SSB-2 binds Par-4 to regulate apoptosis, RanBPM/SSB-1 interact with c-Met for signalling modulation, and SPSB proteins target iNOS for ubiquitination in immune regulation [ PUBMED:16369487 PUBMED:15713673 PUBMED:21199876 ]. The B30.2 domain was first identified as a protein domain encoded by an exon (named B30-2) in the Homo sapiens class I major histocompatibility complex region [ PUBMED:8114113 ], whereas the SPRY domain was first identified in a Dictyostelium discoideum kinase splA and mammalian calcium-release channels ryanodine receptors [ PUBMED:9204703 ]. B30.2 domain consists of PRY and SPRY subdomains. The SPRY domains (after SPla and the RYanodine Receptor) are shorter at the N terminus than the B30.2 domains. The ~200-residue B30.2/SPRY (for B30.2 and/or SPRY) domain is present in a large number of proteins with diverse individual functions in different biological processes. The B30.2/SPRY domain in these proteins is likely to function through protein-protein interaction [ PUBMED:16498413 ].The N-terminal ~60 residues of B30.2/SPRY domains are poorly conserved and, as a consequence, a new domain name PRY was coined for a group of similar sequence segments N-terminal to the SPRY domains [ PUBMED:16498413 ]. The B30.2/SPRY domain contains three highly conserved motifs (LDP, WEVE and LDYE) [ PUBMED:9196055 ]. The B30.2/SPRY domain adopts a highly distorted, compact β-sandwich fold with two additional short β-helices at the N terminus. The β-sandwich of the B30.2/SPRY domain consists of two layers of β-sheets: sheet A composed of eight strands and sheet B composed of seven strands. All the β-strands are in antiparallel arrangement [ PUBMED:16498413 ]. The 5th β-strand corresponding to WEVE motif [ PUBMED:10223295 ]. Both the N- and C-terminal ends of the B30.2/SPRY domains in general are close to each other [ PUBMED:16498413 ]. collapse
GO function:	protein binding (GO:0005515)
Family alignment:	View the Family alignment or the Alignment consensus sequence
There are 24 471 SPRY domains in 20 651 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing SPRY domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing SPRY domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the SPRY domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the SPRY domain.

Protein	Description	Disease / phenotype
MEFV_HUMAN		OMIM:249100 : Familial Mediterranean fever

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a SPRY domain which could be assigned to a KEGG orthologous group, and not all proteins containing SPRY domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

Pfam	SPRY
InterPro	IPR003877