The RICIN domain within your query sequence starts at position 801 and ends at position 925, and its E-value is 1.36e-19.

SGVLINMALGKCVSIENITVTLEDCDGSSQLQQFNYTWVRLIKHGEWCVAPIPEKGSLTLYHCDNRNNRLKWLHKSASAFHPELVDHIVFENYQQLLCMEGNFSQKTLKLAACNPMELQQKWKFE
RICIN

RICIN

Ricin-type beta-trefoil
SMART ACC:SM000458
Description:Carbohydrate-binding domain formed from presumed gene triplication.
InterPro ACC:IPR000772
InterPro abstract:

Ricin is a legume lectin from the seeds of the castor bean plant, Ricinus communis. The seeds are poisonous to people, animals and insects and just one milligram of ricin can kill an adult.

Primary structure analysis has shown the presence of a similar domain in many carbohydrate-recognition proteins like plant and bacterial AB-toxins, glycosidases or proteases [ PUBMED:9603958 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 38 185 RICIN domains in 35 446 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing RICIN domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing RICIN domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the RICIN domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a RICIN domain which could be assigned to a KEGG orthologous group, and not all proteins containing RICIN domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamRicin_B_lectin
PROSITESHIGA_RICIN
InterProIPR000772