The PGAM domain within your query sequence starts at position 251 and ends at position 396, and its E-value is 4.98e-6.

SIYLCRHGESELNLKGRIGGDPGLSPRGREFSKHLAQFISDQNIKDLKVWTSQMKRTIQTAEALSVPYEQWKVLNEIDAGVCEEMTYEEIQDHYPLEFALRDQDKYRPMKTWCSGWSPSSWNWRGRRMCWSFATRLSCAASWPTSL
PGAM

PGAM

Phosphoglycerate mutase family
SMART ACC:SM000855
Description:Phosphoglycerate mutase (PGAM) and bisphosphoglycerate mutase (BPGM) are structurally related enzymes that catalyse reactions involving the transfer of phospho groups between the three carbon atoms of phosphoglycerate (PUBMED:2847721), (PUBMED:2831102), (PUBMED:10958932). Both enzymes can catalyse three different reactions with different specificities, the isomerization of 2-phosphoglycerate (2-PGA) to 3-phosphoglycerate (3-PGA) with 2,3-diphosphoglycerate (2,3-DPG) as the primer of the reaction, the synthesis of 2,3-DPG from 1,3-DPG with 3-PGA as a primer and the degradation of 2,3-DPG to 3-PGA (phosphatase activity). In mammals, PGAM is a dimeric protein with two isoforms, the M (muscle) and B (brain) forms. In yeast, PGAM is a tetrameric protein.
InterPro ACC:IPR013078
InterPro abstract:

The histidine phosphatase superfamily is so named because catalysis centres on a conserved His residue that is transiently phosphorylated during the catalytic cycle. Other conserved residues contribute to a 'phosphate pocket' and interact with the phospho group of substrate before, during and after its transfer to the His residue. Structure and sequence analyses show that different families contribute … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 102 482 PGAM domains in 101 852 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PGAM domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PGAM domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Metabolic

Relevant references for this domain

Primary literature for the PGAM domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PGAM domain which could be assigned to a KEGG orthologous group, and not all proteins containing PGAM domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR013078
PfamPGAM