The FA domain within your query sequence starts at position 310 and ends at position 357, and its E-value is 2.25e-10.

SKFGSISYKHRYSGRTALQMSRDLSIQLPRPNQNVVRSRSKTYPKRVA
FA

FA

FERM adjacent (FA)
SMART ACC:SM001195
Description:This region is found adjacent to Band 4.1 / FERM domains in a subset of FERM containing protein. The region has been hypothesised to play a role in regulatory adaptation, based on similarity to other protein kinase (PUBMED:16626485). .
InterPro ACC:IPR014847
InterPro abstract:

This region is found adjacent to Band 4.1 / FERM domains ( IPR000299 ) in a group of animal FERM containing proteins. The region has been hypothesised to play a role in regulatory adaptation, based on similarity to other protein kinase substrates [ PUBMED:16626485 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 691 FA domains in 11 679 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FA domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FA domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the FA domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FA domain which could be assigned to a KEGG orthologous group, and not all proteins containing FA domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamFA
InterProIPR014847