The TLC domain within your query sequence starts at position 112 and ends at position 321, and its E-value is 4.2e-60.

SKFNESGQLLVFHLSAVAWCFYVIVTEGYLTNPRSLWEDYPHVYLSFQVKFFYLGQLAYWLHSLPELYFQKVRKEEVPRQLQYICLYLLHITGAYLLNLSRLGLILLLLQYSTEALFHMARLFHFADENNERLFNAWAAVFGVTRLFILTLAVLTIGFGLARVENQVFDPEKGNFNTLPCRLGMLLLVCVAQAWLMWRFIHSQLRHWREY
TLC

TLC

TRAM, LAG1 and CLN8 homology domains.
SMART ACC:SM000724
Description:Protein domain with at least 5 transmembrane alpha-helices. Lag1p and Lac1p are essential for acyl-CoA-dependent ceramide synthesis, TRAM is a subunit of the translocon and the CLN8 gene is mutated in Northern epilepsy syndrome. The family may possess multiple functions such as lipid trafficking, metabolism, or sensing. Trh homologues possess additional homeobox domains.
InterPro ACC:IPR006634
InterPro abstract:

TLC is a protein domain with at least 5 transmembrane α-helices. Lag1p and Lac1p are essential for acyl-CoA-dependent ceramide synthesis [ PUBMED:11694577 ], TRAM is a subunit of the translocon and the CLN8 gene is mutated in Northern epilepsy syndrome. Proteins containing this domain may possess multiple functions such … expand

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 11 135 TLC domains in 11 114 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing TLC domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing TLC domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:
Binding / catalysis:Unknown

Relevant references for this domain

Primary literature for the TLC domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a TLC domain which could be assigned to a KEGG orthologous group, and not all proteins containing TLC domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006634