The FDX-ACB domain within your query sequence starts at position 126 and ends at position 218, and its E-value is 1.5e-32.

SKYPAVFNDISFWLPSENYTENDFYDIVRTVGGDLVEKVDLIDKFEHPKTHRTSHCYRITYRHMERTLSQREVGNVHQAVQEAAVQLLGVEGR
FDX-ACB

FDX-ACB

Ferredoxin-fold anticodon binding domain
SMART ACC:SM000896
Description:This is the anticodon binding domain found in some phenylalanyl tRNA synthetases. The domain has a ferredoxin fold, consisting of an alpha+beta sandwich with anti-parallel beta-sheets (beta-alpha-beta x2).
InterPro ACC:IPR005121
InterPro abstract:

Aminoacyl-tRNA synthetases (aaRSs) play a crucial role in the translation of the genetic code by means of covalent attachment of amino acids to their cognate tRNAs. Phenylalanine-tRNA synthetase (PheRS, also known as Phenylalanine-tRNA ligase) is known to be among the most complex enzymes of the aaRS family. Bacterial and mitochondrial PheRSs share a ferredoxin-fold anticodon binding (FDX-ACB) … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 24 139 FDX-ACB domains in 24 139 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing FDX-ACB domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing FDX-ACB domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Translation

Relevant references for this domain

Primary literature for the FDX-ACB domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a FDX-ACB domain which could be assigned to a KEGG orthologous group, and not all proteins containing FDX-ACB domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR005121
PfamFDX-ACB