The Zpr1 domain within your query sequence starts at position 49 and ends at position 207, and its E-value is 1.47e-93.

SLCMNCYRNGTTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLTVRSQEDMNREVVKTDSATTRIPELDFEIPAFSQKGALTTVEGLISRAISGLEQDQPTRRAVEGAIAERIDEFIGKLKDLKQMASPFTLVIDDPSGNSFVEN
Zpr1

Zpr1

Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
SMART ACC:SM000709
Description: -
InterPro ACC:IPR004457
InterPro abstract:

This entry represents ZPR1-type zinc finger domains. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus.

The function of ZPR1 from archaea and eukaryotes … expand

GO function:zinc ion binding (GO:0008270)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 207 Zpr1 domains in 1 670 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Zpr1 domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Zpr1 domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Zpr1 domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Zpr1 domain which could be assigned to a KEGG orthologous group, and not all proteins containing Zpr1 domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR004457