The Matrilin_ccoil domain within your query sequence starts at position 433 and ends at position 479, and its E-value is 8.93e-14.

SLISIEDACGCGATLAFQEKVSSHLQKLNTKLDNILKKLKVTEYGQV
Matrilin_ccoil

Matrilin_ccoil

Trimeric coiled-coil oligomerisation domain of matrilin
SMART ACC:SM001279
Description:This short domain is a coiled coil structure and has a single cysteine residue at the start which is likely to form a di-sulfide bridge with a corresponding cysteine in an upstream EGF (SM00181) domain thereby spanning a VWA (SM00327) domain. All three domains can be associated together as in the cartilage matrix protein matrilin, where this domain is likely to be responsible for oligomerisation PMID:9287130.
InterPro ACC:IPR019466
InterPro abstract:

This entry represents a short domain found the matrilin (cartilage matrix) proteins. It forms a coiled coil structure and contains a single cysteine residue at its start which is likely to form a di-sulphide bridge with a corresponding cysteine in an upstream EGF domain, thereby spanning the VWA domain of the protein ( IPR002035 expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 1 789 Matrilin_ccoil domains in 1 789 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Matrilin_ccoil domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Matrilin_ccoil domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the Matrilin_ccoil domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Matrilin_ccoil domain which could be assigned to a KEGG orthologous group, and not all proteins containing Matrilin_ccoil domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR019466
PfamMatrilin_ccoil