The Leuk-A4-hydro_C domain within your query sequence starts at position 523 and ends at position 668, and its E-value is 1.31e-46.

SLTRPVEALFQLWTAEPLEQAAASASAIDISKWRTFQTALFLDRLLDGSPLPQEVVMSLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLCTGALKSFALEVFYQTQGRLHPNLRRTIQQIL
Leuk-A4-hydro_C

Leuk-A4-hydro_C

Leukotriene A4 hydrolase, C-terminal
SMART ACC:SM001263
Description:Members of this family adopt a structure consisting of two layers of parallel alpha-helices, five in the inner layer and four in the outer, arranged in an antiparallel manner, with perpendicular loops containing short helical segments on top. They are required for the formation of a deep cleft harbouring the catalytic Zn2+ site in Leukotriene A4 hydrolase (PUBMED:11175901).
InterPro ACC:IPR015211
InterPro abstract:

This C-terminal domain is found in peptidases belonging to MEROPS peptidase family M1, particularly: aminopeptidase-1 of Caenorhabditis elegans, aminopeptidase O, aminopeptidase B and the bifunctional leukotriene A4 (LTA-4) hydrolase/aminopeptidase.

GO function:zinc ion binding (GO:0008270), metallopeptidase activity (GO:0008237)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 3 901 Leuk-A4-hydro_C domains in 3 898 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing Leuk-A4-hydro_C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing Leuk-A4-hydro_C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a Leuk-A4-hydro_C domain which could be assigned to a KEGG orthologous group, and not all proteins containing Leuk-A4-hydro_C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamLeuk-A4-hydro_C
InterProIPR015211