The WIF domain within your query sequence starts at position 35 and ends at position 179, and its E-value is 8.47e-90.

SLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVNVIVMNSEGNTILRTPQNAIFFKTCQQ
WIF

WIF

Wnt-inhibitory factor-1 like domain
SMART ACC:SM000469
Description:Occurs as extracellular domain in metazoan Ryk receptor tyrosine kinases. C. elegans Ryk is required for cell-cuticle recognition. WIF-1 binds to Wnt and inhibits its activity.
InterPro ACC:IPR003306
InterPro abstract:

Wnt morphogens control embryonic development and homeostasis in adult tissues. In vertebrates the N-terminal WIF domain (WIF-1WD) of Wnt inhibitory factor 1 (WIF-1) binds Wnt ligands.

This entry represents the WIF domain, it is found in the RYK tyrosine kinase receptors and WIF the Wnt-inhibitory-factor. The domain is extracellular and contains two conserved cysteines that may form a … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 302 WIF domains in 302 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing WIF domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing WIF domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the WIF domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a WIF domain which could be assigned to a KEGG orthologous group, and not all proteins containing WIF domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

KEGG orthologous groups

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003306