The A2M_recep domain within your query sequence starts at position 1353 and ends at position 1440, and its E-value is 1.85e-38.

SNMVIADVKMLSGFIPLKPTVKKLERLEHISRTEVSNNNVLLYLDQVTNQTLAFSFIIQQDISVRNLQPAIVKVYDYYETDEVAYAEY
A2M_recep

A2M_recep

A-macroglobulin receptor
SMART ACC:SM001361
Description:This family includes the receptor domain region of the alpha-2-macroglobulin family.
InterPro ACC:IPR009048
InterPro abstract:

This entry represents the receptor-binding domain (RBD) of alpha-2-macroglobulin and related proteins. The RBD is located at the C terminus, its structure having an immunoglobulin-like fold consists of a sandwich of nine strands in two sheets with a Greek-key topology [ PUBMED:11106161 PUBMED:9634697 expand

GO component:extracellular region (GO:0005576)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 5 943 A2M_recep domains in 5 897 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing A2M_recep domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing A2M_recep domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the A2M_recep domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a A2M_recep domain which could be assigned to a KEGG orthologous group, and not all proteins containing A2M_recep domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR009048
PfamA2M_recep