The MUTSac domain within your query sequence starts at position 695 and ends at position 888, and its E-value is 1.6e-81.

SNVLIITGPNMSGKSTYLKQIALCQIMAQIGSYVPAEYASFRIAAQIFTRISTDDDIETNSSTFMKEMKEIAYILHNANDKSLILIDELGRGTNTEEGIGISYAVCEHLLSIKAFTLFTTHFLELCHLDALYLNVENMHFEVQHVKNTSRNKDAILYTYKLSRGLTEEKNYGLKAAEASSLPSSIVLDARDITT
MUTSac

MUTSac

ATPase domain of DNA mismatch repair MUTS family
SMART ACC:SM000534
Description: -
InterPro ACC:IPR000432
InterPro abstract:

This entry represents the C-terminal domain found in proteins in the MutS family of DNA mismatch repair proteins. The C-terminal region of MutS is comprised of the ATPase domain and the HTH (helix-turn-helix) domain, the latter being involved in dimer contacts. Yeast MSH3 [ PUBMED:8510668 ], bacterial proteins involved … expand

GO process:mismatch repair (GO:0006298)
GO function:ATP binding (GO:0005524), mismatched DNA binding (GO:0030983)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 42 358 MUTSac domains in 42 333 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing MUTSac domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing MUTSac domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the MUTSac domain is listed below. Automatically-derived, secondary literature is also available.

Disease genes where sequence variants are found in this domain

UniRef sequences and OMIM curated human diseases associated with missense mutations within the MUTSac domain.

ProteinDescriptionDisease / phenotype
MSH2_HUMANOMIM:120435 : Colorectal cancer, hereditary nonpolyposis, type 1
OMIM:114500 : Ovarian cancer ; Muir-Torre syndrome
OMIM:158320 : no description
MSH6_HUMANOMIM:600678 : {Cancer susceptibility} ; Endometrial carcinoma ; Colorectal cancer, hereditary nonpolyposis, type 5
OMIM:114500 : no description

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a MUTSac domain which could be assigned to a KEGG orthologous group, and not all proteins containing MUTSac domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

PfamMutS_C
InterProIPR000432
PROSITEDNA_MISMATCH_REPAIR_2