The CADG domain within your query sequence starts at position 26 and ends at position 134, and its E-value is 1.86e-10.

SPATTGTFLLTVYTLFSKVHSDRNVYPSAGVLFVHVLEREYFKGEFPPYPKPGEVSNDPITFNTNLMGYPDRPGWLRYIQRTPYSDGVLYGSPTAENVGKPTIIEITAY
CADG

CADG

Dystroglycan-type cadherin-like domains.
SMART ACC:SM000736
Description:Cadherin-homologous domains present in metazoan dystroglycans and alpha/epsilon sarcoglycans, yeast Axl2p and in a very large protein from magnetotactic bacteria. Likely to bind calcium ions.
InterPro ACC:IPR006644
InterPro abstract:

In animals, cadherin domain-containing proteins are adhesion molecules that modulate a wide variety of processes including cell polarization and migration but they have also been identified in yeast and magnetotactic bacteria. Crystal structures have revealed that multiple cadherin domains form Ca 2+ -dependent rod-like structures with a conserved Ca 2+ -binding pocket at … expand

GO component:membrane (GO:0016020)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 15 915 CADG domains in 6 264 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing CADG domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing CADG domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Cellular role:Signalling
Binding / catalysis:Likely calcium ions.

Relevant references for this domain

Primary literature for the CADG domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a CADG domain which could be assigned to a KEGG orthologous group, and not all proteins containing CADG domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR006644