The PAN_AP domain within your query sequence starts at position 21 and ends at position 104, and its E-value is 2.65e-9.

SPLNDFQLFRGTELRNLLHTAVPGPWQEDVADAEECARRCGPLLDCRAFHYNMSSHGCQLLPWTQHSLHTQLYHSSLCHLFQKK
PAN_AP

PAN_AP

divergent subfamily of APPLE domains
SMART ACC:SM000473
Description:Apple-like domains present in Plasminogen, C. elegans hypothetical ORFs and the extracellular portion of plant receptor-like protein kinases. Predicted to possess protein- and/or carbohydrate-binding functions.
InterPro ACC:IPR003609
InterPro abstract:

Plasma kallikrein ( EC:3.4.21.34 ) and coagulation factor XI ( EC:3.4.21.27 ) are two related plasma serine proteases activated by factor XIIA and which share the same domain topology: an N-terminal region that contains four tandem repeats of about 90 amino … expand

Family alignment:View the Family alignment or the Alignment consensus sequence
There are 16 227 PAN_AP domains in 10 380 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing PAN_AP domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing PAN_AP domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the PAN_AP domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a PAN_AP domain which could be assigned to a KEGG orthologous group, and not all proteins containing PAN_AP domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003609