The eIF5C domain within your query sequence starts at position 625 and ends at position 712, and its E-value is 8.43e-31.

SPVLRNYIKRAADHLEALAAIEDFFLEHETLVTSMAKVLMAFYQLEILAEETILSWFSQRDTTDEGQQLRKNQQLQRFIQWLREAEEE
eIF5C

eIF5C

Domain at the C-termini of GCD6, eIF-2B epsilon, eIF-4 gamma and eIF-5
SMART ACC:SM000515
Description: -
InterPro ACC:IPR003307
InterPro abstract:

Translation initiation is a sophisticated, well regulated and highly coordinated cellular process in eukaryotes, in which at least 11 eukaryotic initiation factors (eIFs) are included. The W2 domain (two invariant tryptophans) is a region of ~165 amino acids which is found in the C terminus of the following eIFs [ PUBMED:8520487 expand

GO function:protein binding (GO:0005515)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 4 417 eIF5C domains in 4 416 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing eIF5C domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing eIF5C domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Relevant references for this domain

Primary literature for the eIF5C domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a eIF5C domain which could be assigned to a KEGG orthologous group, and not all proteins containing eIF5C domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR003307