The ArfGap domain within your query sequence starts at position 9 and ends at position 119, and its E-value is 4.52e-41.

SPVYDPSWASVNRGTFICDECCSVHRSLGRHISQVRHLKHTAWPPTLLQMVETLYNNGANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRE
ArfGap

ArfGap

Putative GTP-ase activating proteins for the small GTPase, ARF
SMART ACC:SM000105
Description:Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
InterPro ACC:IPR001164
InterPro abstract:

Proteins containing this domain include ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [ PUBMED:9446556 ]. The GTP-bound form of ARF is essential … expand

GO function:GTPase activator activity (GO:0005096)
Family alignment:View the Family alignment or the Alignment consensus sequence
There are 21 774 ArfGap domains in 21 759 proteins in SMART's NRDB database.

Taxonomic distribution of proteins containing ArfGap domains

The tree below includes only several representative species and genera. The complete taxonomic breakdown of all proteins containing ArfGap domains can be accessed here. Click the counts or percentage values to display the corresponding proteins.

Predicted cellular role

Binding / catalysis:Arf-binding, activation of Arf Ras-like GTPases

Relevant references for this domain

Primary literature for the ArfGap domain is listed below. Automatically-derived, secondary literature is also available.

KEGG pathways involving proteins which contain this domain

This information is based on the mapping of SMART genomic protein database to KEGG orthologous groups. Percentages are related to the number of proteins containing a ArfGap domain which could be assigned to a KEGG orthologous group, and not all proteins containing ArfGap domains. Please note that proteins can be included in multiple pathways, ie. the numbers below will not add to 100%.

KEGG pathways

Some of these pathways are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

KEGG orthologous groups

Some of these KOs are included in the interactive Pathways Explorer overview maps. Select an overview map and click the button below to highlight them in iPath.

3D structures in PDB containing this domain

Links to other resources describing this domain

InterProIPR001164